PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g48350.1.p
Common NameBRADI_1g48350, LOC100846364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 762aa    MW: 86532.2 Da    PI: 7.0801
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g48350.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.12.2e-2149135290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Y++Y++++GFsvrk k+++   ++ i +++++Cskeg + +e  +  +++ +r+ trt+Cka+++ + +++g+w v+++   HnH+la
  Bradi1g48350.1.p  49 LYCDYGHRIGFSVRKGKQSYVIGTRIIRTKDYYCSKEGLKYDEPVT--EANFNRPDTRTNCKAMVRFRVDDKGRWTVIRFIPVHNHQLA 135
                       7********************99999***************99988..9999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.8E-1949135IPR004330FAR1 DNA binding domain
PfamPF105511.0E-31256349IPR018289MULE transposase domain
PROSITE profilePS509669.186537573IPR007527Zinc finger, SWIM-type
PfamPF044344.1E-6538570IPR007527Zinc finger, SWIM-type
SMARTSM005756.0E-6548575IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MDSSQDSPMS KNGEEAKKGE DYGNGLSRKE AAEEFIGCVV HSEEEAYRLY CDYGHRIGFS  60
VRKGKQSYVI GTRIIRTKDY YCSKEGLKYD EPVTEANFNR PDTRTNCKAM VRFRVDDKGR  120
WTVIRFIPVH NHQLAKPGER HMLRSAKSFA VGKSGVIDPA SAESHPMNGL SDRTVDDTVE  180
PPGYTIRDCY NHENVQGITL IGAGDCQSLV SYFKRRTNEE GMFYWDVQVD QEGRMTNFFF  240
RDGKSKNDYD CFGDAVIFDT TYRTNKYSLI CAPFVGVNHH WHNIVFGCAF LLDDSTASYV  300
WLFKSFLESM GGRSPKSIFT DQDEAIMQAA EQVFPNTQHC FSYWHILKNA QSHLGTVNTS  360
QDFQNMFMKC MQGSDTKMEL EESWAAMLHE YKLQDNDWLN DLYRFHNRWC SAFNKDTFDG  420
GINSSQWGEV SNNILTGIAD ESTSLTRFAL LLEKAVKSLR RNESEEDFRC SQTAPVRAIK  480
HSTVLKQAAE SYTHRIYKLF EAEFLDGCGA TSCHENSCGG NLLRFEITMQ GRGSKVWTVL  540
LDTSTMEISC GCRKFERMGL LCSHALKAFS LQNVDTIPEK YILKRWTKDA RRSMYKLSQE  600
DSTQQECTEA ELAYRNRAMQ YAYSLIMKSQ ELEESRKIFW DSLETGEKAL EVFFEIRSLH  660
AQPAKDASKT GKKKSSKGPS NKKARQALPS SSPVPGILAQ ANEHQFQAAQ DAHGNSTIGR  720
PFYFQAFSST PCQPNQIYIH PNTMPVCAPQ DLSAYPAIRP S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3711050.0AK371105.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2125C10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561049.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
TrEMBLI1H0P90.0I1H0P9_BRADI; Uncharacterized protein
STRINGBRADI1G48350.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-100FAR1-related sequence 5